General Information

  • ID:  hor002382
  • Uniprot ID:  O46617
  • Protein name:  Motilin
  • Gene name:  MLN
  • Organism:  Equus caballus (Horse)
  • Family:  Motilin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Equus (genus), Equidae (family), Perissodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0031788 motilin receptor binding
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  FVPIFTYSELQRMQEKERNRGQ
  • Length:  22
  • Propeptide:  FVPIFTYSELQRMQEKERNRGQKKSLGLQQRSEEVGSLDPTEAAEEEGKEVIKLTAPVEIGMRMNSRQLEKYRAALEGLLSEVLLSTQNAAK
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Plays an important role in the regulation of interdigestive gastrointestinal motility and indirectly causes rhythmic contraction of duodenal and colonic smooth muscle.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: 10.7+/-1.8*10(-9) M
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-O46617-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor002382_AF2.pdbhor002382_ESM.pdb

Physical Information

Mass: 313185 Formula: C121H190N36O36S
Absent amino acids: ACDHW Common amino acids: EQR
pI: 9.3 Basic residues: 4
Polar residues: 5 Hydrophobic residues: 5
Hydrophobicity: -121.36 Boman Index: -7698
Half-Life: 1.1 hour Half-Life Yeast: 3 min
Half-Life E.Coli: 2 min Aliphatic Index 48.64
Instability Index: 4895 Extinction Coefficient cystines: 1490
Absorbance 280nm: 70.95

Literature

  • PubMed ID:  30677392
  • Title:  A Verification Study of Gastrointestinal Motility-Stimulating Action of Guinea-Pig Motilin Using Isolated Gastrointestinal Strips From Rabbits and Guinea-Pigs